Human GLP2(Glucagon Like Peptide 2) ELISA Kit

Human GLP2(Glucagon Like Peptide 2) ELISA Kit

Human Glucagon Like Peptide 2 (GLP2) ELISA Kit
RD-GLP2-Hu-48Tests	Reddot Biotech	48 Tests	EUR 521

Human Glucagon Like Peptide 2 (GLP2) ELISA Kit
RD-GLP2-Hu-96Tests	Reddot Biotech	96 Tests	EUR 723

Human Glucagon-Like Peptide 2 (GLP2) Peptide
abx670345-1mg	Abbexa	1 mg	EUR 356
Shipped within 1 week.

Human GLP2(Glucagon Like Peptide 2) ELISA Kit
EH3143	FN Test	96T	EUR 524.1
Detection range: 0.156-10 ng/ml Alias: GLP2/glucagon-like peptide 2
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Homo sapiens;Sensitivity: 0.094 ng/ml

Human Glucagon Like Peptide 2 (GLP2) ELISA Kit
CED059Hu-10x96wellstestplate	Cloud-Clone	10x96-wells test plate	EUR 4731.5
The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Glucagon Like Peptide 2 (GLP2) were tested on 3 different plates, 8 replicates in each plate CV(%) = SD/meanX100 Intra-Assay: CV<10% Inter-Assay: CV<12 Show more
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Human Glucagon Like Peptide 2 (GLP2) in serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids.

Human Glucagon Like Peptide 2 (GLP2) ELISA Kit
CED059Hu-1x48wellstestplate	Cloud-Clone	1x48-wells test plate	EUR 477.3
The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Glucagon Like Peptide 2 (GLP2) were tested on 3 different plates, 8 replicates in each plate CV(%) = SD/meanX100 Intra-Assay: CV<10% Inter-Assay: CV<12 Show more
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Human Glucagon Like Peptide 2 (GLP2) in serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids.

Human Glucagon Like Peptide 2 (GLP2) ELISA Kit
CED059Hu-1x96wellstestplate	Cloud-Clone	1x96-wells test plate	EUR 639
The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Glucagon Like Peptide 2 (GLP2) were tested on 3 different plates, 8 replicates in each plate CV(%) = SD/meanX100 Intra-Assay: CV<10% Inter-Assay: CV<12 Show more
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Human Glucagon Like Peptide 2 (GLP2) in serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids.

Human Glucagon Like Peptide 2 (GLP2) ELISA Kit
CED059Hu-5x96wellstestplate	Cloud-Clone	5x96-wells test plate	EUR 2575.5
The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Glucagon Like Peptide 2 (GLP2) were tested on 3 different plates, 8 replicates in each plate CV(%) = SD/meanX100 Intra-Assay: CV<10% Inter-Assay: CV<12 Show more
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Human Glucagon Like Peptide 2 (GLP2) in serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids.

Human Glucagon Like Peptide 2 (GLP2) ELISA Kit
4-CED059Hu	Cloud-Clone	EUR 4782.00 EUR 2526.00 EUR 640.00	10 plates of 96 wells 5 plates of 96 wells 1 plate of 96 wells
Known also as Glucagon Like Peptide 2 elisa. Alternative names of the recognized antigen: n/a
Description: Enzyme-linked immunosorbent assay based on the Competitive Inhibition method for detection of Human Glucagon Like Peptide 2 (GLP2) in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids with no significant corss-reactivity with analogues from other species.

Human Glucagon Like Peptide 2 ELISA Kit (GLP2)
RK01470	Abclonal	96 Tests	EUR 521

Glucagon Like Peptide 2 (GLP2) Antibody
20-abx178980	Abbexa	EUR 425.00 EUR 133.00 EUR 1205.00 EUR 578.00 EUR 328.00	100 ug 10 ug 1 mg 200 ug 50 ug
Shipped within 5-7 working days.

Glucagon Like Peptide 2 (GLP2) Antibody
20-abx178981	Abbexa	EUR 453.00 EUR 133.00 EUR 1302.00 EUR 620.00 EUR 342.00	100 ug 10 ug 1 mg 200 ug 50 ug
Shipped within 5-7 working days.

Glucagon Like Peptide 2 (GLP2) Antibody
20-abx178982	Abbexa	EUR 467.00 EUR 133.00 EUR 1358.00 EUR 648.00 EUR 356.00	100 ug 10 ug 1 mg 200 ug 50 ug
Shipped within 5-7 working days.

Glucagon Like Peptide 2 (GLP2) Antibody
20-abx130461	Abbexa	EUR 425.00 EUR 133.00 EUR 1205.00 EUR 578.00 EUR 328.00	100 ug 10 ug 1 mg 200 ug 50 ug
Shipped within 5-7 working days.

Recombinant Glucagon Like Peptide 2 (GLP2)
4-RPD059Hu01	Cloud-Clone	EUR 413.60 EUR 214.00 EUR 1276.00 EUR 492.00 EUR 884.00 EUR 340.00 EUR 3040.00	100 ug 10ug 1 mg 200 ug 500 ug 50ug 5 mg
Uniprot ID: P01275 Buffer composition: PBS, pH 7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300. Form: Freeze-dried powder Predicted Molecular Mass (KD): 11.2kDa Isoelectric Point: 4
Description: Recombinant Human Glucagon Like Peptide 2 expressed in: E.coli

Recombinant Glucagon Like Peptide 2 (GLP2)
4-RPD059Mu01	Cloud-Clone	EUR 440.48 EUR 221.00 EUR 1376.80 EUR 525.60 EUR 951.20 EUR 358.00 EUR 3292.00	100 ug 10ug 1 mg 200 ug 500 ug 50ug 5 mg
Uniprot ID: P55095 Buffer composition: PBS, pH 7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300. Form: Freeze-dried powder Predicted Molecular Mass (KD): 33.8kDa Isoelectric Point: 4
Description: Recombinant Mouse Glucagon Like Peptide 2 expressed in: E.coli

Pig glucagon like peptide 2(GLP2) ELISA kit
CSB-EQ027317PI-24T	Cusabio	1 plate of 24 wells	EUR 165
Sample volume: 50-100ul Detection wavelength: 450nm Assay performance time: 1 to 4 hours.
Description: Quantitativesandwich ELISA kit for measuring Pig glucagon like peptide 2 (GLP2) in samples from serum, plasma, tissue homogenates. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price.

Pig glucagon like peptide 2(GLP2) ELISA kit
1-CSB-EQ027317PI	Cusabio	EUR 900.00 EUR 5476.00 EUR 2900.00	1 plate of 96 wells 10 plates of 96 wells each 5 plates of 96 wells each
Sample volume: 50-100ul Detection wavelength: 450nm Assay performance time: 1 to 4 hours.
Description: Quantitativesandwich ELISA kit for measuring Pig glucagon like peptide 2(GLP2) in samples from serum, plasma, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits.

Mouse Glucagon Like Peptide 2 (GLP2) ELISA Kit
CED059Mu-10x96wellstestplate	Cloud-Clone	10x96-wells test plate	EUR 4862.4
The Intra-assay Precision is determined when 3 samples with low, middle and high level of Mouse Glucagon Like Peptide 2 (GLP2) were tested on 3 different plates, 8 replicates in each plate CV(%) = SD/meanX100 Intra-Assay: CV<10% Inter-Assay: CV<12 Show more
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Mouse Glucagon Like Peptide 2 (GLP2) in serum, plasma and other biological fluids.

Mouse Glucagon Like Peptide 2 (GLP2) ELISA Kit
CED059Mu-1x48wellstestplate	Cloud-Clone	1x48-wells test plate	EUR 488.08
The Intra-assay Precision is determined when 3 samples with low, middle and high level of Mouse Glucagon Like Peptide 2 (GLP2) were tested on 3 different plates, 8 replicates in each plate CV(%) = SD/meanX100 Intra-Assay: CV<10% Inter-Assay: CV<12 Show more
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Mouse Glucagon Like Peptide 2 (GLP2) in serum, plasma and other biological fluids.

Mouse Glucagon Like Peptide 2 (GLP2) ELISA Kit
CED059Mu-1x96wellstestplate	Cloud-Clone	1x96-wells test plate	EUR 654.4
The Intra-assay Precision is determined when 3 samples with low, middle and high level of Mouse Glucagon Like Peptide 2 (GLP2) were tested on 3 different plates, 8 replicates in each plate CV(%) = SD/meanX100 Intra-Assay: CV<10% Inter-Assay: CV<12 Show more
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Mouse Glucagon Like Peptide 2 (GLP2) in serum, plasma and other biological fluids.

Mouse Glucagon Like Peptide 2 (GLP2) ELISA Kit
CED059Mu-5x96wellstestplate	Cloud-Clone	5x96-wells test plate	EUR 2644.8
The Intra-assay Precision is determined when 3 samples with low, middle and high level of Mouse Glucagon Like Peptide 2 (GLP2) were tested on 3 different plates, 8 replicates in each plate CV(%) = SD/meanX100 Intra-Assay: CV<10% Inter-Assay: CV<12 Show more
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Mouse Glucagon Like Peptide 2 (GLP2) in serum, plasma and other biological fluids.

Mouse Glucagon Like Peptide 2 (GLP2) ELISA Kit
4-CED059Mu	Cloud-Clone	EUR 4913.00 EUR 2595.00 EUR 655.00	10 plates of 96 wells 5 plates of 96 wells 1 plate of 96 wells
Known also as Glucagon Like Peptide 2 elisa. Alternative names of the recognized antigen: n/a
Description: Enzyme-linked immunosorbent assay based on the Competitive Inhibition method for detection of Mouse Glucagon Like Peptide 2 (GLP2) in samples from Serum, plasma and other biological fluids. with no significant corss-reactivity with analogues from other species.

Pig Glucagon Like Peptide 2 (GLP2) ELISA Kit
CED059Po-10x96wellstestplate	Cloud-Clone	10x96-wells test plate	EUR 5647.8
The Intra-assay Precision is determined when 3 samples with low, middle and high level of Pig Glucagon Like Peptide 2 (GLP2) were tested on 3 different plates, 8 replicates in each plate CV(%) = SD/meanX100 Intra-Assay: CV<10% Inter-Assay: CV<12%
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Pig Glucagon Like Peptide 2 (GLP2) in serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids.

Pig Glucagon Like Peptide 2 (GLP2) ELISA Kit
CED059Po-1x48wellstestplate	Cloud-Clone	1x48-wells test plate	EUR 552.76
The Intra-assay Precision is determined when 3 samples with low, middle and high level of Pig Glucagon Like Peptide 2 (GLP2) were tested on 3 different plates, 8 replicates in each plate CV(%) = SD/meanX100 Intra-Assay: CV<10% Inter-Assay: CV<12%
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Pig Glucagon Like Peptide 2 (GLP2) in serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids.

Pig Glucagon Like Peptide 2 (GLP2) ELISA Kit
CED059Po-1x96wellstestplate	Cloud-Clone	1x96-wells test plate	EUR 746.8
The Intra-assay Precision is determined when 3 samples with low, middle and high level of Pig Glucagon Like Peptide 2 (GLP2) were tested on 3 different plates, 8 replicates in each plate CV(%) = SD/meanX100 Intra-Assay: CV<10% Inter-Assay: CV<12%
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Pig Glucagon Like Peptide 2 (GLP2) in serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids.

Pig Glucagon Like Peptide 2 (GLP2) ELISA Kit
CED059Po-5x96wellstestplate	Cloud-Clone	5x96-wells test plate	EUR 3060.6
The Intra-assay Precision is determined when 3 samples with low, middle and high level of Pig Glucagon Like Peptide 2 (GLP2) were tested on 3 different plates, 8 replicates in each plate CV(%) = SD/meanX100 Intra-Assay: CV<10% Inter-Assay: CV<12%
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Pig Glucagon Like Peptide 2 (GLP2) in serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids.

Pig Glucagon Like Peptide 2 (GLP2) ELISA Kit
4-CED059Po	Cloud-Clone	EUR 5698.00 EUR 3011.00 EUR 747.00	10 plates of 96 wells 5 plates of 96 wells 1 plate of 96 wells
Known also as Glucagon Like Peptide 2 elisa. Alternative names of the recognized antigen: n/a
Description: Enzyme-linked immunosorbent assay based on the Competitive Inhibition method for detection of Pig Glucagon Like Peptide 2 (GLP2) in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids with no significant corss-reactivity with analogues from other species.

Mouse Glucagon Like Peptide 2 ELISA Kit (GLP2)
RK02852	Abclonal	96 Tests	EUR 521

Porcine Glucagon Like Peptide 2 ELISA Kit (GLP2)
RK03328	Abclonal	96 Tests	EUR 573

Human Glucagon Like Peptide 2 (GLP2) Protein
20-abx652336	Abbexa	EUR 578.00 EUR 258.00 EUR 1720.00 EUR 690.00 EUR 425.00	100 ug 10 ug 1 mg 200 ug 50 ug
Shipped within 5-15 working days.

Human Glucagon Like Peptide 2 (GLP2) Peptide (OVA)
20-abx165542	Abbexa	EUR 578.00 EUR 258.00 EUR 1720.00 EUR 690.00 EUR 425.00	100 ug 10 ug 1 mg 200 ug 50 ug
Shipped within 5-7 working days.

Human Glucagon Like Peptide 2 (GLP2) Peptide (OVA)
20-abx651238	Abbexa	EUR 453.00 EUR 230.00 EUR 1219.00 EUR 523.00 EUR 328.00	100 ug 10 ug 1 mg 200 ug 50 ug
Shipped within 5-7 working days.

ELISA kit for Human GLP2 (Glucagon Like Peptide 2)
ELK3108	ELK Biotech	1 plate of 96 wells	EUR 432
A monoclonal antibody specific to Glucagon Like Peptide 2 (GLP2) has been pre-coated onto a microplate. A competitive inhibition reaction is launched between biotin labeled Glucagon Like Peptide 2 (GLP2) and unlabeled Glucagon Like Peptide 2 (GLP2) ( Show more
Description: A competitive Inhibition ELISA kit for detection of Glucagon Like Peptide 2 from Human in samples from blood, serum, plasma, cell culture fluid and other biological fluids.

ELISA kit for Human Glucagon like peptide 2 (GLP2)
KTE62531-48T	Abbkine	48T	EUR 332
GLP-2 is a 33 amino acid peptide with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD in humans. GLP-2 is created by specific post-translational proteolytic cleavage of proglucagon in a process that also liberates the related glucagon-like peptide-1 ( Show more
Description: Quantitative sandwich ELISA for measuring Human Glucagon like peptide 2 (GLP2) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Human Glucagon like peptide 2 (GLP2)
KTE62531-5platesof96wells	Abbkine	5 plates of 96 wells	EUR 2115
GLP-2 is a 33 amino acid peptide with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD in humans. GLP-2 is created by specific post-translational proteolytic cleavage of proglucagon in a process that also liberates the related glucagon-like peptide-1 ( Show more
Description: Quantitative sandwich ELISA for measuring Human Glucagon like peptide 2 (GLP2) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Human Glucagon like peptide 2 (GLP2)
KTE62531-96T	Abbkine	96T	EUR 539
GLP-2 is a 33 amino acid peptide with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD in humans. GLP-2 is created by specific post-translational proteolytic cleavage of proglucagon in a process that also liberates the related glucagon-like peptide-1 ( Show more
Description: Quantitative sandwich ELISA for measuring Human Glucagon like peptide 2 (GLP2) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

OVA Conjugated Glucagon Like Peptide 2 (GLP2)
4-CPD059Ca21	Cloud-Clone	EUR 413.60 EUR 214.00 EUR 1276.00 EUR 492.00 EUR 884.00 EUR 340.00 EUR 3040.00	100 ug 10ug 1 mg 200 ug 500 ug 50ug 5 mg
Uniprot ID: Inquire Buffer composition: PBS, pH 7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300. Form: Freeze-dried powder Predicted Molecular Mass (KD): 1536.6Da Isoelectric Point: Inquire
Description: Recombinant Dog Glucagon Like Peptide 2 expressed in: E.coli

OVA conjugated Glucagon Like Peptide 2 (GLP2)
4-CPD059Hu21	Cloud-Clone	EUR 413.60 EUR 214.00 EUR 1276.00 EUR 492.00 EUR 884.00 EUR 340.00 EUR 3040.00	100 ug 10ug 1 mg 200 ug 500 ug 50ug 5 mg
Uniprot ID: P01275 Buffer composition: PBS, pH 7.4. Form: Freeze-dried powder Predicted Molecular Mass (KD): Inquire Isoelectric Point: Inquire
Description: Recombinant Human Glucagon Like Peptide 2 expressed in: chemical synthesis

OVA Conjugated Glucagon Like Peptide 2 (GLP2)
4-CPD059Hu22	Cloud-Clone	EUR 312.35 EUR 187.00 EUR 896.32 EUR 365.44 EUR 630.88 EUR 272.00 EUR 2090.80	100 ug 10ug 1 mg 200 ug 500 ug 50ug 5 mg
Uniprot ID: P01275 Buffer composition: PBS, pH 7.4. Form: Freeze-dried powder Predicted Molecular Mass (KD): Inquire Isoelectric Point: Inquire
Description: Recombinant Human Glucagon Like Peptide 2 expressed in: chemical synthesis

OVA Conjugated Glucagon Like Peptide 2 (GLP2)
4-CPD059Mu21	Cloud-Clone	EUR 216.48 EUR 161.00 EUR 536.80 EUR 245.60 EUR 391.20 EUR 208.00 EUR 1192.00	100 ug 10ug 1 mg 200 ug 500 ug 50ug 5 mg
Uniprot ID: P55095 Buffer composition: PBS, pH 7.4. Form: Freeze-dried powder Predicted Molecular Mass (KD): Inquire Isoelectric Point: Inquire
Description: Recombinant Mouse Glucagon Like Peptide 2 expressed in: chemical synthesis

OVA Conjugated Glucagon Like Peptide 2 (GLP2)
4-CPD059Ra21	Cloud-Clone	EUR 216.48 EUR 161.00 EUR 536.80 EUR 245.60 EUR 391.20 EUR 208.00 EUR 1192.00	100 ug 10ug 1 mg 200 ug 500 ug 50ug 5 mg
Uniprot ID: Inquire Buffer composition: PBS, pH 7.4. Form: Freeze-dried powder Predicted Molecular Mass (KD): Inquire Isoelectric Point: Inquire
Description: Recombinant Rat Glucagon Like Peptide 2 expressed in: chemical synthesis

Dog Glucagon Like Peptide 2 (GLP2) Peptide (OVA)
20-abx651864	Abbexa	EUR 578.00 EUR 258.00 EUR 1720.00 EUR 690.00 EUR 425.00	100 ug 10 ug 1 mg 200 ug 50 ug
Shipped within 5-7 working days.

ELISA kit for Mouse GLP2 (Glucagon Like Peptide 2)
ELK7440	ELK Biotech	1 plate of 96 wells	EUR 432
A monoclonal antibody specific to Glucagon Like Peptide 2 (GLP2) has been pre-coated onto a microplate. A competitive inhibition reaction is launched between biotin labeled Glucagon Like Peptide 2 (GLP2) and unlabeled Glucagon Like Peptide 2 (GLP2) ( Show more
Description: A competitive Inhibition ELISA kit for detection of Glucagon Like Peptide 2 from Mouse in samples from blood, serum, plasma, cell culture fluid and other biological fluids.

ELISA kit for Pig GLP2 (Glucagon Like Peptide 2)
ELK8084	ELK Biotech	1 plate of 96 wells	EUR 526
A monoclonal antibody specific to Glucagon Like Peptide 2 (GLP2) has been pre-coated onto a microplate. A competitive inhibition reaction is launched between biotin labeled Glucagon Like Peptide 2 (GLP2) and unlabeled Glucagon Like Peptide 2 (GLP2) ( Show more
Description: A competitive Inhibition ELISA kit for detection of Glucagon Like Peptide 2 from Pig in samples from blood, serum, plasma, cell culture fluid and other biological fluids.

Glucagon Like Peptide 2 (GLP2) Polyclonal Antibody (Human)
4-PAD059Hu01	Cloud-Clone	EUR 247.00 EUR 2510.00 EUR 625.00 EUR 310.00 EUR 214.00	100ul 10ml 1ml 200ul 20ul
Sequence of the immunogen: Synthetic Peptide, GLP2 conjugated to OVA Buffer composition: 0.01M PBS, pH7.4, containing 0.05% Proclin-300, 50% glycerol.
Description: A Rabbit polyclonal antibody against Human Glucagon Like Peptide 2 (GLP2)

Glucagon Like Peptide 2 (GLP2) Polyclonal Antibody (Human), APC
4-PAD059Hu01-APC	Cloud-Clone	EUR 345.00 EUR 3275.00 EUR 912.00 EUR 440.00 EUR 219.00	100ul 10ml 1ml 200ul 20ul
Sequence of the immunogen: Synthetic Peptide, GLP2 conjugated to OVA Buffer composition: 0.01M PBS, pH7.4, containing 0.05% Proclin-300, 50% glycerol.
Description: A Rabbit polyclonal antibody against Human Glucagon Like Peptide 2 (GLP2). This antibody is labeled with APC.

Glucagon Like Peptide 2 (GLP2) Polyclonal Antibody (Human), Biotinylated
4-PAD059Hu01-Biotin	Cloud-Clone	EUR 311.00 EUR 2460.00 EUR 727.00 EUR 381.00 EUR 219.00	100ul 10ml 1ml 200ul 20ul
Sequence of the immunogen: Synthetic Peptide, GLP2 conjugated to OVA Buffer composition: 0.01M PBS, pH7.4, containing 0.05% Proclin-300, 50% glycerol.
Description: A Rabbit polyclonal antibody against Human Glucagon Like Peptide 2 (GLP2). This antibody is labeled with Biotin.

Glucagon Like Peptide 2 (GLP2) Polyclonal Antibody (Human), Cy3
4-PAD059Hu01-Cy3	Cloud-Clone	EUR 419.00 EUR 4325.00 EUR 1175.00 EUR 545.00 EUR 251.00	100ul 10ml 1ml 200ul 20ul
Sequence of the immunogen: Synthetic Peptide, GLP2 conjugated to OVA Buffer composition: 0.01M PBS, pH7.4, containing 0.05% Proclin-300, 50% glycerol.
Description: A Rabbit polyclonal antibody against Human Glucagon Like Peptide 2 (GLP2). This antibody is labeled with Cy3.

Glucagon Like Peptide 2 (GLP2) Polyclonal Antibody (Human), FITC
4-PAD059Hu01-FITC	Cloud-Clone	EUR 296.00 EUR 2640.00 EUR 750.00 EUR 372.00 EUR 195.00	100ul 10ml 1ml 200ul 20ul
Sequence of the immunogen: Synthetic Peptide, GLP2 conjugated to OVA Buffer composition: 0.01M PBS, pH7.4, containing 0.05% Proclin-300, 50% glycerol.
Description: A Rabbit polyclonal antibody against Human Glucagon Like Peptide 2 (GLP2). This antibody is labeled with FITC.

Glucagon Like Peptide 2 (GLP2) Polyclonal Antibody (Human), HRP
4-PAD059Hu01-HRP	Cloud-Clone	EUR 316.00 EUR 2855.00 EUR 807.00 EUR 398.00 EUR 206.00	100ul 10ml 1ml 200ul 20ul
Sequence of the immunogen: Synthetic Peptide, GLP2 conjugated to OVA Buffer composition: 0.01M PBS, pH7.4, containing 0.05% Proclin-300, 50% glycerol.
Description: A Rabbit polyclonal antibody against Human Glucagon Like Peptide 2 (GLP2). This antibody is labeled with HRP.

Glucagon Like Peptide 2 (GLP2) Polyclonal Antibody (Human), PE
4-PAD059Hu01-PE	Cloud-Clone	EUR 296.00 EUR 2640.00 EUR 750.00 EUR 372.00 EUR 195.00	100ul 10ml 1ml 200ul 20ul
Sequence of the immunogen: Synthetic Peptide, GLP2 conjugated to OVA Buffer composition: 0.01M PBS, pH7.4, containing 0.05% Proclin-300, 50% glycerol.
Description: A Rabbit polyclonal antibody against Human Glucagon Like Peptide 2 (GLP2). This antibody is labeled with PE.

Human Glucagon like peptide 2 (GLP2/GLP-2) Control/blocking peptide #1
GLP25-P	Alpha Diagnostics	100 ug	EUR 164

Glucagon Like Peptide 2 (GLP2) Polyclonal Antibody (Human), APC-Cy7
4-PAD059Hu01-APC-Cy7	Cloud-Clone	EUR 571.00 EUR 6430.00 EUR 1705.00 EUR 760.00 EUR 319.00	100ul 10ml 1ml 200ul 20ul
Sequence of the immunogen: Synthetic Peptide, GLP2 conjugated to OVA Buffer composition: 0.01M PBS, pH7.4, containing 0.05% Proclin-300, 50% glycerol.
Description: A Rabbit polyclonal antibody against Human Glucagon Like Peptide 2 (GLP2). This antibody is labeled with APC-Cy7.

Human Glucagon Like Peptide 2 ELISA kit
E01G0032-192T	B-Gene	192 tests	EUR 1270
Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT Show more
Description: A competitive ELISA for quantitative measurement of Human Glucagon Like Peptide 2 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Human Glucagon Like Peptide 2 ELISA kit
E01G0032-48	B-Gene	1 plate of 48 wells	EUR 520
Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT Show more
Description: A competitive ELISA for quantitative measurement of Human Glucagon Like Peptide 2 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Human Glucagon Like Peptide 2 ELISA kit
E01G0032-96	B-Gene	1 plate of 96 wells	EUR 685
Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT Show more
Description: A competitive ELISA for quantitative measurement of Human Glucagon Like Peptide 2 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Glucagon Like Peptide-2
20-abx260495	Abbexa	EUR 2499.00 EUR 230.00 EUR 328.00	100 mg 1 mg 5 mg
Shipped within 5-10 working days.

Human Glucagon Like Peptide-2
7-02215	CHI Scientific	1mg	Ask for price

Human Glucagon Like Peptide-2
7-02216	CHI Scientific	5mg	Ask for price

Human Glucagon Like Peptide-2
7-02217	CHI Scientific	100mg	Ask for price

Rabbit Anti-human Glucagon like peptide 2 (GLP2/GLP-2) IgG #1, aff pure
GLP25-A	Alpha Diagnostics	100 ug	EUR 482

Rat Glucagon Like Peptide 2 ELISA kit
E02G0032-192T	B-Gene	192 tests	EUR 1270
Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT Show more
Description: A competitive ELISA for quantitative measurement of Rat Glucagon Like Peptide 2 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Rat Glucagon Like Peptide 2 ELISA kit
E02G0032-48	B-Gene	1 plate of 48 wells	EUR 520
Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT Show more
Description: A competitive ELISA for quantitative measurement of Rat Glucagon Like Peptide 2 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Rat Glucagon Like Peptide 2 ELISA kit
E02G0032-96	B-Gene	1 plate of 96 wells	EUR 685
Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT Show more
Description: A competitive ELISA for quantitative measurement of Rat Glucagon Like Peptide 2 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Mouse Glucagon Like Peptide 2 ELISA kit
E03G0032-192T	B-Gene	192 tests	EUR 1270
Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT Show more
Description: A competitive ELISA for quantitative measurement of Mouse Glucagon Like Peptide 2 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Mouse Glucagon Like Peptide 2 ELISA kit
E03G0032-48	B-Gene	1 plate of 48 wells	EUR 520
Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT Show more
Description: A competitive ELISA for quantitative measurement of Mouse Glucagon Like Peptide 2 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Mouse Glucagon Like Peptide 2 ELISA kit
E03G0032-96	B-Gene	1 plate of 96 wells	EUR 685
Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT Show more
Description: A competitive ELISA for quantitative measurement of Mouse Glucagon Like Peptide 2 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Rabbit Glucagon Like Peptide 2 ELISA kit
E04G0032-192T	B-Gene	192 tests	EUR 1270
Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT Show more
Description: A competitive ELISA for quantitative measurement of Rabbit Glucagon Like Peptide 2 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Rabbit Glucagon Like Peptide 2 ELISA kit
E04G0032-48	B-Gene	1 plate of 48 wells	EUR 520
Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT Show more
Description: A competitive ELISA for quantitative measurement of Rabbit Glucagon Like Peptide 2 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Rabbit Glucagon Like Peptide 2 ELISA kit
E04G0032-96	B-Gene	1 plate of 96 wells	EUR 685
Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT Show more
Description: A competitive ELISA for quantitative measurement of Rabbit Glucagon Like Peptide 2 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Goat Glucagon Like Peptide 2 ELISA kit
E06G0032-192T	B-Gene	192 tests	EUR 1270
Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT Show more
Description: A competitive ELISA for quantitative measurement of Goat Glucagon Like Peptide 2 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Goat Glucagon Like Peptide 2 ELISA kit
E06G0032-48	B-Gene	1 plate of 48 wells	EUR 520
Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT Show more
Description: A competitive ELISA for quantitative measurement of Goat Glucagon Like Peptide 2 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Goat Glucagon Like Peptide 2 ELISA kit
E06G0032-96	B-Gene	1 plate of 96 wells	EUR 685
Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT Show more
Description: A competitive ELISA for quantitative measurement of Goat Glucagon Like Peptide 2 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Monkey Glucagon Like Peptide 2 ELISA kit
E09G0032-192T	B-Gene	192 tests	EUR 1270
Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT Show more
Description: A competitive ELISA for quantitative measurement of Monkey Glucagon Like Peptide 2 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Monkey Glucagon Like Peptide 2 ELISA kit
E09G0032-48	B-Gene	1 plate of 48 wells	EUR 520
Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT Show more
Description: A competitive ELISA for quantitative measurement of Monkey Glucagon Like Peptide 2 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Monkey Glucagon Like Peptide 2 ELISA kit
E09G0032-96	B-Gene	1 plate of 96 wells	EUR 685
Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT Show more
Description: A competitive ELISA for quantitative measurement of Monkey Glucagon Like Peptide 2 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Dog Glucagon Like Peptide 2 ELISA kit
E08G0032-192T	B-Gene	192 tests	EUR 1270
Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT Show more
Description: A competitive ELISA for quantitative measurement of Canine Glucagon Like Peptide 2 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Dog Glucagon Like Peptide 2 ELISA kit
E08G0032-48	B-Gene	1 plate of 48 wells	EUR 520
Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT Show more
Description: A competitive ELISA for quantitative measurement of Canine Glucagon Like Peptide 2 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Dog Glucagon Like Peptide 2 ELISA kit
E08G0032-96	B-Gene	1 plate of 96 wells	EUR 685
Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT Show more
Description: A competitive ELISA for quantitative measurement of Canine Glucagon Like Peptide 2 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Pig Glucagon Like Peptide 2 ELISA kit
E07G0032-192T	B-Gene	192 tests	EUR 1270
Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT Show more
Description: A competitive ELISA for quantitative measurement of Porcine Glucagon Like Peptide 2 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Pig Glucagon Like Peptide 2 ELISA kit
E07G0032-48	B-Gene	1 plate of 48 wells	EUR 520
Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT Show more
Description: A competitive ELISA for quantitative measurement of Porcine Glucagon Like Peptide 2 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Pig Glucagon Like Peptide 2 ELISA kit
E07G0032-96	B-Gene	1 plate of 96 wells	EUR 685
Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT Show more
Description: A competitive ELISA for quantitative measurement of Porcine Glucagon Like Peptide 2 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Human Glucagon-Like Peptide 2 (GLP-2) ELISA Kit
abx053249-96tests	Abbexa	96 tests	EUR 637
Shipped within 5-10 working days.

Human Glucagon-Like Peptide 2 (GLP-2) ELISA Kit
20-abx151671	Abbexa	EUR 7378.00 EUR 3933.00 EUR 911.00	10 × 96 tests 5 × 96 tests 96 tests
Shipped within 5-7 working days.

Human Glucagon-Like Peptide 2 (GLP-2) ELISA Kit
abx252541-96tests	Abbexa	96 tests	EUR 668
Shipped within 5-12 working days.

Human Glucagon- like peptide 2 receptor, GLP2R ELISA KIT
ELI-31226h	Lifescience Market	96 Tests	EUR 824

Human Glucagon-Like Peptide 2 Receptor (GLP2R) ELISA Kit
20-abx384957	Abbexa	EUR 7378.00 EUR 3933.00 EUR 911.00	10 × 96 tests 5 × 96 tests 96 tests
Shipped within 5-12 working days.

Human Glucagon Like Peptide 1 ELISA kit
E01G0031-192T	B-Gene	192 tests	EUR 1270
Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT Show more
Description: A competitive ELISA for quantitative measurement of Human Glucagon Like Peptide 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Human Glucagon Like Peptide 1 ELISA kit
E01G0031-48	B-Gene	1 plate of 48 wells	EUR 520
Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT Show more
Description: A competitive ELISA for quantitative measurement of Human Glucagon Like Peptide 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Human Glucagon Like Peptide 1 ELISA kit
E01G0031-96	B-Gene	1 plate of 96 wells	EUR 685
Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT Show more
Description: A competitive ELISA for quantitative measurement of Human Glucagon Like Peptide 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Guinea pig Glucagon Like Peptide 2 ELISA kit
E05G0032-192T	B-Gene	192 tests	EUR 1270
Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT Show more
Description: A competitive ELISA for quantitative measurement of Guinea pig Glucagon Like Peptide 2 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Guinea pig Glucagon Like Peptide 2 ELISA kit
E05G0032-48	B-Gene	1 plate of 48 wells	EUR 520
Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT Show more
Description: A competitive ELISA for quantitative measurement of Guinea pig Glucagon Like Peptide 2 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Guinea pig Glucagon Like Peptide 2 ELISA kit
E05G0032-96	B-Gene	1 plate of 96 wells	EUR 685
Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT Show more
Description: A competitive ELISA for quantitative measurement of Guinea pig Glucagon Like Peptide 2 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

ELISA kit for Human GLP-2 (Glucagon Like Peptide 2)
E-EL-H2238	Elabscience Biotech	1 plate of 96 wells	EUR 534
Gentaur's GLP-2 ELISA kit utilizes the Competitive-ELISA principle. The micro ELISA plate provided in this kit has been pre-coated with Human GLP-2. During the reaction, Human GLP-2 in the sample or standard competes with a fixed amount of Human GLP- Show more
Description: A competitive ELISA kit for quantitative measurement of Human GLP-2 (Glucagon Like Peptide 2) in samples from Serum, Plasma, Cell supernatant

Rat Glucagon-Like Peptide 2 (GLP-2) ELISA Kit
20-abx055192	Abbexa	EUR 7237.00 EUR 3855.00 EUR 895.00	10 × 96 tests 5 × 96 tests 96 tests
Shipped within 5-7 working days.

Pig Glucagon-Like Peptide 2 (GLP-2) ELISA Kit
20-abx154930	Abbexa	EUR 7911.00 EUR 4215.00 EUR 973.00	10 × 96 tests 5 × 96 tests 96 tests
Shipped within 5-7 working days.

Mouse Glucagon-Like Peptide 2 (GLP-2) ELISA Kit
abx254129-96tests	Abbexa	96 tests	EUR 707
Shipped within 5-12 working days.

Pig Glucagon-Like Peptide 2 (GLP-2) ELISA Kit
abx255480-96tests	Abbexa	96 tests	EUR 786
Shipped within 5-12 working days.

Mouse Glucagon-Like Peptide 2 (GLP-2) ELISA Kit
20-abx258023	Abbexa	EUR 7378.00 EUR 3933.00 EUR 911.00	10 × 96 tests 5 × 96 tests 96 tests
Shipped within 5-7 working days.

Mouse glucagon-like peptide-2, GLP-2 ELISA Kit
CSB-E13622m-24T	Cusabio	1 plate of 24 wells	EUR 165
Sample volume: 50-100ul Detection wavelength: 450nm Assay performance time: 1 to 4 hours.
Description: Quantitativesandwich ELISA kit for measuring Mouse glucagon-like peptide-2, GLP-2 in samples from serum, plasma, tissue homogenates, cell lysates. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price.

Mouse glucagon-like peptide-2, GLP-2 ELISA Kit
1-CSB-E13622m	Cusabio	EUR 900.00 EUR 5476.00 EUR 2900.00	1 plate of 96 wells 10 plates of 96 wells each 5 plates of 96 wells each
Sample volume: 50-100ul Detection wavelength: 450nm Assay performance time: 1 to 4 hours.
Description: Quantitativesandwich ELISA kit for measuring Mouse glucagon-like peptide-2, GLP-2 in samples from serum, plasma, tissue homogenates, cell lysates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits.

Rat glucagon-like peptide-2, GLP-2 ELISA Kit
CSB-E14203r-24T	Cusabio	1 plate of 24 wells	EUR 165
Sample volume: 50-100ul Detection wavelength: 450nm Assay performance time: 1 to 4 hours.
Description: Quantitativesandwich ELISA kit for measuring Rat glucagon-like peptide-2, GLP-2 in samples from serum, plasma, tissue homogenates. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price.

Rat glucagon-like peptide-2, GLP-2 ELISA Kit
1-CSB-E14203r	Cusabio	EUR 900.00 EUR 5476.00 EUR 2900.00	1 plate of 96 wells 10 plates of 96 wells each 5 plates of 96 wells each
Sample volume: 50-100ul Detection wavelength: 450nm Assay performance time: 1 to 4 hours.
Description: Quantitativesandwich ELISA kit for measuring Rat glucagon-like peptide-2, GLP-2 in samples from serum, plasma, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits.

Chicken Glucagon-Like Peptide 2 (GLP-2) ELISA Kit
abx351132-96tests	Abbexa	96 tests	EUR 825
Shipped within 5-12 working days.

Monkey Glucagon-Like Peptide 2 (GLP-2) ELISA Kit
abx359065-96tests	Abbexa	96 tests	EUR 825
Shipped within 5-12 working days.

Dog Glucagon-Like Peptide 2 (GLP-2) ELISA Kit
abx355473-96tests	Abbexa	96 tests	EUR 926
Shipped within 5-12 working days.

Rabbit Glucagon-Like Peptide 2 (GLP-2) ELISA Kit
abx363522-96tests	Abbexa	96 tests	EUR 825
Shipped within 5-12 working days.

Glucagon-Like Peptide 2 (GLP-2) AssayMax ELISA Kit
ERG3771-1	AssayPro	96 Well Plate	EUR 477

Human Glucagon Like Peptide 2 (GLP-2) CLIA Kit
abx196691-96tests	Abbexa	96 tests	EUR 825
Shipped within 5-12 working days.

Human Glucagon-Like Peptide 2 (GLP-2) CLIA Kit
20-abx490480	Abbexa	EUR 7973.00 EUR 4246.00 EUR 981.00	10 × 96 tests 5 × 96 tests 96 tests
Please enquire.

GLP-2 ELISA Kit| Mouse Glucagon Like Peptide 2 ELISA Kit
EF013645	Lifescience Market	96 Tests	EUR 689

GLP-2 ELISA Kit| Porcine Glucagon Like Peptide 2 ELISA Kit
EF016607	Lifescience Market	96 Tests	EUR 689

Human Glucagon-like Peptide 2 (GLP-2) Antibody
10971-05011	AssayPro	150 ug	EUR 217

GLP-2 Human Glucagon Like Peptide-2 protein
PROTP01275-6	BosterBio	Regular: 5mg	EUR 317
Description: Glucagon Like Peptide-2 contains 34 amino acids having a molecular mass of 3922.38 Dalton.

Rat Glucagon-Like Peptide 2 Receptor (GLP2R) ELISA Kit
20-abx257646	Abbexa	EUR 7237.00 EUR 3855.00 EUR 895.00	10 × 96 tests 5 × 96 tests 96 tests
Shipped within 5-12 working days.

Mouse Glucagon- like peptide 2 receptor, Glp2r ELISA KIT
ELI-12543m	Lifescience Market	96 Tests	EUR 865

Mouse Glucagon-Like Peptide 2 Receptor (GLP2R) ELISA Kit
20-abx389406	Abbexa	EUR 7378.00 EUR 3933.00 EUR 911.00	10 × 96 tests 5 × 96 tests 96 tests
Shipped within 5-12 working days.

Rat GLP2R(Glucagon-like peptide 2 receptor) ELISA Kit
ER1594	FN Test	96T	EUR 524.1
Detection range: 31.2-2000 pg/ml Uniprot ID: Q9Z0W0
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Rattus;Sensitivity: 10pg/ml

Human Glucagon Like Peptide 1 (GLP1) ELISA Kit
DLR-GLP1-Hu-48T	DL Develop	48T	EUR 479
Should the Human Glucagon Like Peptide 1 (GLP1) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A competitive inhibition quantitative ELISA assay kit for detection of Human Glucagon Like Peptide 1 (GLP1) in samples from serum, plasma or other biological fluids.

Human Glucagon Like Peptide 1 (GLP1) ELISA Kit
DLR-GLP1-Hu-96T	DL Develop	96T	EUR 621
Should the Human Glucagon Like Peptide 1 (GLP1) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A competitive inhibition quantitative ELISA assay kit for detection of Human Glucagon Like Peptide 1 (GLP1) in samples from serum, plasma or other biological fluids.

Human Glucagon-Like Peptide 1 (GLP1) ELISA Kit
abx250294-96tests	Abbexa	96 tests	EUR 668
Shipped within 5-12 working days.

ELISA kit for Human Glucagon-like peptide 1
EK2263	SAB	96 tests	EUR 553
Description: Enzyme-linked immunosorbent assay kit for quantification of Human Glucagon-like peptide 1 in samples from serum, plasma, tissue homogenates and other biological fluids.

Human GLP1/ Glucagon-like peptide 1 ELISA Kit
E1018Hu	Sunlong	1 Kit	EUR 571

Human GLP1(Glucagon-like peptide 1) ELISA Kit
EH1053	FN Test	96T	EUR 476.25
Detection range: 0.313-20 ng/ml Uniprot ID: P0C6A0 Alias: GLP-1(Glucagon Like Peptide 1)/GLP1/GRPP
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Homo sapiens;Sensitivity: 0.188 ng/ml

Human Glucagon- like peptide 1, GLP1 ELISA KIT
ELI-02720h	Lifescience Market	96 Tests	EUR 824

Human Glucagon Like Peptide 1 (GLP1) ELISA Kit
CEA804Hu-10x96wellstestplate	Cloud-Clone	10x96-wells test plate	EUR 4273.35
The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Glucagon Like Peptide 1 (GLP1) were tested on 3 different plates, 8 replicates in each plate CV(%) = SD/meanX100 Intra-Assay: CV<10% Inter-Assay: CV<12 Show more
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Human Glucagon Like Peptide 1 (GLP1) in serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids.

Human Glucagon Like Peptide 1 (GLP1) ELISA Kit
CEA804Hu-1x48wellstestplate	Cloud-Clone	1x48-wells test plate	EUR 439.57
The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Glucagon Like Peptide 1 (GLP1) were tested on 3 different plates, 8 replicates in each plate CV(%) = SD/meanX100 Intra-Assay: CV<10% Inter-Assay: CV<12 Show more
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Human Glucagon Like Peptide 1 (GLP1) in serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids.

Human Glucagon Like Peptide 1 (GLP1) ELISA Kit
CEA804Hu-1x96wellstestplate	Cloud-Clone	1x96-wells test plate	EUR 585.1
The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Glucagon Like Peptide 1 (GLP1) were tested on 3 different plates, 8 replicates in each plate CV(%) = SD/meanX100 Intra-Assay: CV<10% Inter-Assay: CV<12 Show more
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Human Glucagon Like Peptide 1 (GLP1) in serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids.

Human Glucagon Like Peptide 1 (GLP1) ELISA Kit
CEA804Hu-5x96wellstestplate	Cloud-Clone	5x96-wells test plate	EUR 2332.95
The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Glucagon Like Peptide 1 (GLP1) were tested on 3 different plates, 8 replicates in each plate CV(%) = SD/meanX100 Intra-Assay: CV<10% Inter-Assay: CV<12 Show more
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Human Glucagon Like Peptide 1 (GLP1) in serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids.

Human Glucagon Like Peptide 1 (GLP1) ELISA Kit
4-CEA804Hu	Cloud-Clone	EUR 4324.00 EUR 2283.00 EUR 586.00	10 plates of 96 wells 5 plates of 96 wells 1 plate of 96 wells
Known also as Glucagon Like Peptide 1 elisa. Alternative names of the recognized antigen: n/a
Description: Enzyme-linked immunosorbent assay based on the Competitive Inhibition method for detection of Human Glucagon Like Peptide 1 (GLP1) in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids with no significant corss-reactivity with analogues from other species.

Human Glucagon-Like Peptide 1 (GLP1) ELISA Kit
abx574197-96tests	Abbexa	96 tests	EUR 668
Shipped within 5-12 working days.

Human Glucagon Like Peptide 1 ELISA Kit (GLP1)
RK01468	Abclonal	96 Tests	EUR 521

Human Glucagon Like Peptide 1 (GLP1) ELISA Kit
RDR-GLP1-Hu-48Tests	Reddot Biotech	48 Tests	EUR 500

Human Glucagon Like Peptide 1 (GLP1) ELISA Kit
RDR-GLP1-Hu-96Tests	Reddot Biotech	96 Tests	EUR 692

Human Glucagon Like Peptide 1 (GLP1) ELISA Kit
RD-GLP1-Hu-48Tests	Reddot Biotech	48 Tests	EUR 478

Human Glucagon Like Peptide 1 (GLP1) ELISA Kit
RD-GLP1-Hu-96Tests	Reddot Biotech	96 Tests	EUR 662

ELISA kit for Mouse GLP-2 (Glucagon Like Peptide 2)
E-EL-M2633	Elabscience Biotech	1 plate of 96 wells	EUR 534
Gentaur's GLP-2 ELISA kit utilizes the Competitive-ELISA principle. The micro ELISA plate provided in this kit has been pre-coated with Mouse GLP-2. During the reaction, Mouse GLP-2 in the sample or standard competes with a fixed amount of Mouse GLP- Show more
Description: A competitive ELISA kit for quantitative measurement of Mouse GLP-2 (Glucagon Like Peptide 2) in samples from Serum, Plasma, Cell supernatant

Rat Glucagon Like Peptide 1 ELISA kit
E02G0031-192T	B-Gene	192 tests	EUR 1270
Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT Show more
Description: A competitive ELISA for quantitative measurement of Rat Glucagon Like Peptide 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Rat Glucagon Like Peptide 1 ELISA kit
E02G0031-48	B-Gene	1 plate of 48 wells	EUR 520
Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT Show more
Description: A competitive ELISA for quantitative measurement of Rat Glucagon Like Peptide 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Rat Glucagon Like Peptide 1 ELISA kit
E02G0031-96	B-Gene	1 plate of 96 wells	EUR 685
Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT Show more
Description: A competitive ELISA for quantitative measurement of Rat Glucagon Like Peptide 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Mouse Glucagon Like Peptide 1 ELISA kit
E03G0031-192T	B-Gene	192 tests	EUR 1270
Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT Show more
Description: A competitive ELISA for quantitative measurement of Mouse Glucagon Like Peptide 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Mouse Glucagon Like Peptide 1 ELISA kit
E03G0031-48	B-Gene	1 plate of 48 wells	EUR 520
Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT Show more
Description: A competitive ELISA for quantitative measurement of Mouse Glucagon Like Peptide 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Mouse Glucagon Like Peptide 1 ELISA kit
E03G0031-96	B-Gene	1 plate of 96 wells	EUR 685
Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT Show more
Description: A competitive ELISA for quantitative measurement of Mouse Glucagon Like Peptide 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Rabbit Glucagon Like Peptide 1 ELISA kit
E04G0031-192T	B-Gene	192 tests	EUR 1270
Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT Show more
Description: A competitive ELISA for quantitative measurement of Rabbit Glucagon Like Peptide 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Rabbit Glucagon Like Peptide 1 ELISA kit
E04G0031-48	B-Gene	1 plate of 48 wells	EUR 520
Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT Show more
Description: A competitive ELISA for quantitative measurement of Rabbit Glucagon Like Peptide 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Rabbit Glucagon Like Peptide 1 ELISA kit
E04G0031-96	B-Gene	1 plate of 96 wells	EUR 685
Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT Show more
Description: A competitive ELISA for quantitative measurement of Rabbit Glucagon Like Peptide 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Goat Glucagon Like Peptide 1 ELISA kit
E06G0031-192T	B-Gene	192 tests	EUR 1270
Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT Show more
Description: A competitive ELISA for quantitative measurement of Goat Glucagon Like Peptide 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Goat Glucagon Like Peptide 1 ELISA kit
E06G0031-48	B-Gene	1 plate of 48 wells	EUR 520
Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT Show more
Description: A competitive ELISA for quantitative measurement of Goat Glucagon Like Peptide 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Goat Glucagon Like Peptide 1 ELISA kit
E06G0031-96	B-Gene	1 plate of 96 wells	EUR 685
Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT Show more
Description: A competitive ELISA for quantitative measurement of Goat Glucagon Like Peptide 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Monkey Glucagon Like Peptide 1 ELISA kit
E09G0031-192T	B-Gene	192 tests	EUR 1270
Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT Show more
Description: A competitive ELISA for quantitative measurement of Monkey Glucagon Like Peptide 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Monkey Glucagon Like Peptide 1 ELISA kit
E09G0031-48	B-Gene	1 plate of 48 wells	EUR 520
Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT Show more
Description: A competitive ELISA for quantitative measurement of Monkey Glucagon Like Peptide 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Monkey Glucagon Like Peptide 1 ELISA kit
E09G0031-96	B-Gene	1 plate of 96 wells	EUR 685
Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT Show more
Description: A competitive ELISA for quantitative measurement of Monkey Glucagon Like Peptide 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Dog Glucagon Like Peptide 1 ELISA kit
E08G0031-192T	B-Gene	192 tests	EUR 1270
Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT Show more
Description: A competitive ELISA for quantitative measurement of Canine Glucagon Like Peptide 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Dog Glucagon Like Peptide 1 ELISA kit
E08G0031-48	B-Gene	1 plate of 48 wells	EUR 520
Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT Show more
Description: A competitive ELISA for quantitative measurement of Canine Glucagon Like Peptide 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Dog Glucagon Like Peptide 1 ELISA kit
E08G0031-96	B-Gene	1 plate of 96 wells	EUR 685
Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT Show more
Description: A competitive ELISA for quantitative measurement of Canine Glucagon Like Peptide 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Pig Glucagon Like Peptide 1 ELISA kit
E07G0031-192T	B-Gene	192 tests	EUR 1270
Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT Show more
Description: A competitive ELISA for quantitative measurement of Porcine Glucagon Like Peptide 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Pig Glucagon Like Peptide 1 ELISA kit
E07G0031-48	B-Gene	1 plate of 48 wells	EUR 520
Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT Show more
Description: A competitive ELISA for quantitative measurement of Porcine Glucagon Like Peptide 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Pig Glucagon Like Peptide 1 ELISA kit
E07G0031-96	B-Gene	1 plate of 96 wells	EUR 685
Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT Show more
Description: A competitive ELISA for quantitative measurement of Porcine Glucagon Like Peptide 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Mouse Glucagon-Like Peptide 2 (GLP-2) Peptide (OVA)
20-abx651239	Abbexa	EUR 300.00 EUR 203.00 EUR 746.00 EUR 342.00 EUR 258.00	100 ug 10 ug 1 mg 200 ug 50 ug
Shipped within 5-7 working days.

Rat Glucagon-Like Peptide 2 (GLP-2) Peptide (OVA)
20-abx651240	Abbexa	EUR 300.00 EUR 203.00 EUR 746.00 EUR 342.00 EUR 258.00	100 ug 10 ug 1 mg 200 ug 50 ug
Shipped within 5-7 working days.

Mouse Glucagon-Like Peptide 2 (GLP-2) CLIA Kit
20-abx490481	Abbexa	EUR 7973.00 EUR 4246.00 EUR 981.00	10 × 96 tests 5 × 96 tests 96 tests
Please enquire.

Pig Glucagon-Like Peptide 2 (GLP-2) CLIA Kit
20-abx490482	Abbexa	EUR 8569.00 EUR 4560.00 EUR 1052.00	10 × 96 tests 5 × 96 tests 96 tests
Please enquire.

Human Glucagon Like Peptide 1 (GLP1), Human, ELISA Kit
QY-E05569	Qayee Biotechnology	96T	EUR 361

GLP2R ELISA Kit| Rat Glucagon-like peptide 2 receptor ELISA Kit
EF018192	Lifescience Market	96 Tests	EUR 689

Glucagon-Like Peptide 2 Receptor (GLP2R) Antibody
20-abx005063	Abbexa	EUR 411.00 EUR 592.00 EUR 182.00 EUR 314.00	100 ul 200 ul 20 ul 50 ul
Shipped within 5-10 working days.

Glucagon-Like Peptide 2 Receptor (GLP2R) Antibody
20-abx005620	Abbexa	EUR 411.00 EUR 592.00 EUR 314.00	100 ul 200 ul 50 ul
Shipped within 5-10 working days.

Glucagon-Like Peptide 2 Receptor (GLP2R) Antibody
abx215627-100ug	Abbexa	100 ug	EUR 439
Shipped within 5-10 working days.

Human GLP2(Glucagon Like Peptide 2) ELISA Kit